Gene ML0450c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible pyridoxine biosynthesis protein SnzP |
| Comments | ML0450c, len: 307 aa. Possible snzP, pyridoxine biosynthesis protein. Highly similar to Rv2606c|YQ06_MYCTU|O06208 snzP, pyridoxine biosynthesis protein from M. tuberculosis (299 aa), Fasta scores: E(): 0, (89.7% identity in 291 aa overlap). Highly conserved in both bacteria and eukaryotes. Highly similar to several pyridoxine biosynthesis proteins and hypothetical proteins e.g. Q9UW83|AF133101 pyroA, pyridoxine biosynthesis protein from Emericella nidulans (304 aa), Fasta scores: E(): 0, (65.9% identity in 299 aa overlap); and SCL2.13c conserved hypothetical protein from Streptomyces coelicolor A3(2) (303 aa). Previously sequenced as YQ06_MYCLE|O07145 (333 aa), Fasta scores: E(): 0, (100.0% identity in 307 aa overlap). Contains Pfam match to entry PF01680, SOR_SNZ family. Contains PS01235 Uncharacterized protein family UPF0019 signature. Belongs to the SOR_SNZ family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 550194 | 551117 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0450c|snzP
VDSAAQSNQAQSVFGQTGTARVKRGMAEMLKGGVIMDVVIPEQARIAEGSGAVAVMALERVPSDIRAQGGVSRMSDPDMIESIIAAVTIPVMAKARIGHFVEAQILQSLGVDYIDESEVLTPADYTHHIDKWKFTVPFVCGATNLGEALRRINEGAAMIRSKGEAGTGDVSNATTHMRAIAGDIRRLTSLSEDELYVAAKELHAPYELVIEVARTNKLPVTLFTAGGIATPADAAMMMQLGAEGIFVGSGIFKSSDPAQRAAAIVKATTFYDDPDVLAKVSRGLGEAMAGIDVEQIAQPDRLAQRGW
Bibliography
No article yet recorded
