Gene ML0493
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible glyoxalase II (Hydroxyacylglutathione hydrolase) (GLX II) |
| Comments | ML0493, len: 218 aa. Possible glyoxalase II (EC 3.1.2.6), highly similar to YP81_MYCTU|Q50640|Rv2581c Possible glyoxalase II from M. tuberculosis (224 aa), Fasta scores: E(): 1.1e-82, (82.0% identity in 222 aa overlap); and CAD94797|Mb2612c from M. bovis (224 aa). Also similar to Q9KXP1|SC9C5.33c Possible hydrolase from Streptomyces coelicolor (235 aa), FASTA scores: E(): 5.4e-38, (47.945% identity in 219 aa overlap); and AAP11173 Hydroxyacylglutathione hydrolase from Bacillus cereus (strain ATCC 14579 / DSM 31) (209 aa), fasta scores: E(): 4.3e-25, (39.048% identity in 210 aa overlap). Also similar to ML1391 and ML1912. Previously sequenced as YP81_MYCLE|Q49649 (218 aa), Fasta scores: E(): 0, (99.5% identity in 218 aa overlap). Contains Pfam match to entry PF00753 lactamase_B, Metallo-beta-lactamase superfamily. Belongs to the glyoxalase II family. Cofactor: Binds two Zinc ions. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 599081 | 599737 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0493|ML0493
VLITGFPAGMLQCNCYVLADRAGTDAVIVDPGQRAMGPLRRILDENRLTPSAVLLTHGHIDHMWSAQKVSDTYGCPTYIHPEDRFMLTDPLFGFGPRVAQVVTGAFFREPKQVVELDRDGDKLDLGSVTVNVDHTPGHTRGSVCFWVAADTDVVLTGDTLFERTIGRTDLFGGSGRDLYRSIVEKLLVLDDKTVVLPGHGNSTTIGAERRFNPFLEGL
Bibliography
No article yet recorded