Gene ML0513
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0513, len: 184 aa. Conserved hypothetical protein, highly similar to YP54_MYCTU|P94999|Rv2554c conserved hypothetical protein from M. tuberculosis (170 aa), Fasta scores: E(): 5.1e-40, (72.0% identity in 161 aa overlap); and CAD94769|Mb2584c from M. bovis (170 aa). Similar to many bacterial hypothetical proteins e.g. Q9KXQ0|SC9C5.24C hypothetical protein from Streptomyces coelicolor (167 aa), Fasta scores: E(): 8.9e-25, (54.8% identity in 155 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 624887 | 625441 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0513|ML0513
VFSSQHRLLYQPSGPDLSKNLDPERGRRLGIDVGSVRIGVAFSDPDGILATPVETVRRYRSAKHLRRLAELVVELQVVEVVVGLPWTLTDRTGSSAKDAIDTAEALARRVAPVPVRLVDERLTTVSAQRLLRAAGVRAKDQRAVIDQAAAVVILQNWLDQCRAATPARADEPTTGSVAGEVIDG
Bibliography
No article yet recorded