Gene ML0517
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Shikimate kinase AroK (SK) |
| Comments | ML0517, len: 199 aa. aroK, shikimate kinase (EC 2.7.1.71), highly similar to AROK_MYCTU|P95014|Rv2539c aroK, shikimate kinase from M. tuberculosis (176 aa), Fasta scores: E(): 0, (79.6% identity in 167 aa overlap); and CAD94753|Mb2568c from M. bovis (176 aa). Similar to many e.g. AROK_ECOLI|P24167 aroK, shikimate kinase I from Escherichia coli (172 aa), Fasta scores: E(): 3.5e-13, (38.0% identity in 166 aa overlap). Contains Pfam match to entry PF01202 SKI, Shikimate kinase. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS01128 Shikimate kinase signature. Belongs to the Shikimate kinase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 628973 | 629572 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0517|aroK
MAPKAVLVGLPGAGKSTIGRRLSKALGVSLLDTDAAIEKQTGRSIADIFAIDGEEEFRRIEEGVVRAALVEHDGVVSLGGGAVTSPGVCAALAGHIVIYLEINAEEAMRRACGSTVRPLLAGPDRAEKFQDLMARRVPLYRRVATIRVDTNCHNLGAVVRYIMARLQAQLATPVSGGDRKSSEAERSGAPLRKSSEVVK
Bibliography
No article yet recorded