Gene ML0518
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 3-dehydroquinate synthase AroB |
| Comments | ML0518, len: 361 aa. aroB, 3-dehydroquinate synthase (EC 4.6.1.3), highly similar to AROB_MYCTU|P36919|Rv2538c aroB, 3-dehydroquinate synthase from M. tuberculosis (362 aa), Fasta scores: E(): 0, (87.3% identity in 361 aa overlap); and CAD94752|Mb2567c from M. bovis (362 aa). Also highly similar to many e.g. Q9KXQ6|AROB_STRCO from Streptomyces coelicolor (363 aa), FASTA scores: E(): 2.1e-77, (58.146% identity in 356 aa overlap). Contains Pfam match to entry PF01761 DHQ_synthase, 3-dehydroquinate synthase. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 629569 | 630654 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0518|aroB
MTNIDAPVTVQVAVDPPYPVVIGTGLSDQLDELLANRHRVAILHQPVLTQTAEAIRSHLAGKGVDAHRIEIPDAEAGKDLSVMDFIWEVLGRIGIGRKDALVSFGGGAATDVAGFAAATWLRGVSIVHVPTTLLGMVDAAVGGKTGINTEAGKNLVGAFHQPLAVLADLATLETLPRKEIASGMAEVVKAGFIADPIILDLIEADPQASLDPMGGVLPELIRRAVTVKAGVVSADEKESELREILNYGHTLAHAIERRERYEWRHGAAVSVGLVFAAELARVAGRLDDATAQRHHTILTSLGLPVSYDADALPQLLEYMAGDKKTRAGVLRFVILDGLAKPGRLVGPDPGLLVTAYAGLSA
Bibliography
No article yet recorded