Gene ML0520c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | ML0520c, len: 202 aa. Probable conserved transmembrane protein, highly similar to P95017|AL123456|Rv2536 Possible membrane protein from M. tuberculosis (230 aa), Fasta scores: E(): 2.6e-45, (63.2% identity in 201 aa overlap); and CAD94750|Mb2565 from M. bovis (230 aa). Contains hydrophobic, possible membrane-spanning regions. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 631180 | 631788 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0520c|ML0520c
MNNWMLRGLVFAALMIVVRLMQGTMINVWQAQSVLISVVLLAVFIIAVVVWAARDGRADAIANPDPDRRRDLAMTWLLTGILVGVLSDAVAWVISLLYNGIYTGGLVSELTTFSAFTALIVFLTGIIGVACGRWRVDRRSPPVPEHSRSGQNRADSNVFAAVCTDDDTPTGELSAAQTKEQTAAVATAESEAPTEIIYHQRA
Bibliography
No article yet recorded