Gene ML0537
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable orotidine 5'-phosphate decarboxylase PyrF (OMP decarboxylase) (OMPDCase) (OMPdecase) |
| Comments | ML0537, len: 282 aa. Probable pyrF, orotidine 5'-phosphate decarboxylase (EC 4.1.1.23), highly similar to DCOP_MYCTU|P77898|Rv1385 pyrF, orotidine 5'-phosphate decarboxylase from M. tuberculosis (274 aa), Fasta scores: E(): 3e-78, (77.3% identity in 282 aa overlap); and CAD94281|Mb1420 from M. bovis (274 aa). Similar to many e.g. DCOP_MYCSM|O08323 pyrF, orotidine 5'-phosphate decarboxylase from Mycobacterium smegmatis (276 aa), Fasta scores: E(): 2.1e-70, (72.5% identity in 280 aa overlap). Contains Pfam match to entry PF00215 OMPdecase, Orotidine 5'-phosphate decarboxylases. Contains PS00156 Orotidine 5'-phosphate decarboxylase active site. Belongs to the OMP decarboxylase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 652995 | 653843 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0537|pyrF
MTGFGARLVEATSRRGQLCLGIDPHPELLRAWDLPTTADGLAAFCDICVEAFSGFAIVKPQVAFFEAYGAAGFAVLEYTIAALRSVGVLVLADAKRGDIGSTMAAYAAAWAGNSPLAADAVTASPYLGFGSLRPLLEVAAAHDRGVFVLASTSNLEGATVQRATFDGRIVAQLIVDQAAFVNREMNRSFHRSEPGCLGYVGVVVGATVFGAPDVSALGGPVLVPGVGAQGGHPEALGGLGGAAPGQLLPAVSRAVLRAGPGVSELRAAGEQMRDAVAYLAAV
Bibliography
No article yet recorded
