Gene ML0540
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Putative integration host factor MihF |
| Comments | ML0540, len: 105 aa. Putative mihF, integration host factor, highly similar at the carboxy terminus to P71658|AL123456|Rv1388 mihF, possible integration host factor from M. tuberculosis (190 aa), Fasta scores: E(): 3.8e-35, (98.1% identity in 105 aa overlap) and CAD94284|Mb1423 from M. bovis (190 aa). And highly similar to P96802|U75344 mihF, integration host factor from Mycobacterium smegmatis (105 aa), Fasta scores: E(): 7.5e-32, (94.1% identity in 102 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 656896 | 657213 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0540|mihF
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLEKFGSA
Bibliography
No article yet recorded