Gene ML0557c (P27)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved lipoprotein LprG |
Comments | ML0557c, len: 238 aa. Probable lprG, conserved lipoprotein, highly similar to LPRG_MYCTU|P71679|Rv1411c lprG, putative lipoprotein from M. tuberculosis (234 aa), Fasta scores: E(): 0, (68.1% identity in 238 aa overlap) and similar to other M. tuberculosis lipoproteins e.g. Rv1270c, Rv1368, Rv2945c. Also similar to CAD94307|Mb1446c from M. bovis (236 aa) and to ML0136 from M. leprae. Contains probable N-terminal signal sequence. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Note that the Rv1410c-Rv1411c operon seems transcribed from two promoters in Mycobacterium bovis BCG (see Bigi et al., 2000). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 674680 | 675396 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0557c|lprG MQAPKHHRRLFAVLATLNTATAVIAGCSSGSNLSSGPLPDATTWVKQATDITKNVTSAHLVLSVNGKITGLPVKTLTGDLTTHPNTVASGNATITLDGADLNANFVVVDGELYATLTPSKWSDFGKASDIYDVASILNPDAGLANVLANFTGAKTEGRDSINGQSAVRISGNVSADAVNKIAPPFNATQPMPATVWIQETGDHQLAQIRIDNKSSGNSVQMTLSNWDEPVQVTKPQVS
Bibliography
No article yet recorded