Gene ML0561
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved membrane protein |
Comments | ML0561, len: 156 aa. Possible conserved membrane protein, highly similar to YE17_MYCTU|P71686|Rv1417 Possible conserved membrane protein from M. tuberculosis (154 aa), Fasta scores: E(): 2.4e-43, (75.5% identity in 143 aa overlap); and CAD94313|Mb1452 from M. bovis (154 aa). Similar to other membrane proteins e.g. Q9RKZ5 Putative membrane protein from Streptomyces coelicolor (156 aa), fasta scores: E(): 2e-05, (27.891% identity in 147 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 678086 | 678556 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0561|ML0561 MTAQLDRDDWDVELRPYWTPLFAYAAAFLIAAAHITVGLLLRIKSSGVVFRTADQVAIGALGLVIASAVLLLTRPRLRVGAAGLLVRNIMFYRIIPWSHVVDVSFPLGSHWARIDLPDDEYIPLMAIQAVDKERAVEAMDAVRALLARYRAGPYGP
Bibliography
No article yet recorded