Gene ML0569c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved exported protein |
Comments | ML0569c, len: 271 aa. Possible conserved exported protein, highly similar to O06825|AL123456|Rv1433 Possible conserved exported protein from M. tuberculosis (271 aa), Fasta scores: E(): 0, (68.3% identity in 271 aa overlap); and CAD94329|Mb1468 from M. bovis (271 aa). Similar to ML0426, ML2446 and ML2664 from M. leprae. Shows similarity to other proteins in M. tuberculosis e.g. Rv2518c, Rv0116c, Rv0192, Rv0483. Previously sequenced as Q49706|U00013 (271 aa), Fasta scores: E(): 0, (100.0% identity in 271 aa overlap). Contains possible N-terminal signal sequence. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 693612 | 694427 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0569c|ML0569c MGIMRAAIRGVLVVIGIAATVIAGPVRVSLAAVNHAHGFAITSILPTRDAVVGVAHPVVVTFGAPVTNRKATELSLKVRSAPAMNGKFDWLDSKVVQWVPDRYWPEHSTIALTVGNLSTNFKTGPAILGIADISNHTFTVTIDGVEAETPPPLPSPHHRPHWGEEGVMPASMGKTEFPTPTGKYTVMSKDRSVIMDSSSVGIPVDDPEGYRLSVDYAVRISSRGLYIHSAPWAVQSMGFDNTSHGCISLSPADAEWYYNTVNIGDPVIVKE
Bibliography
No article yet recorded