Gene ML0572
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable triosephosphate isomerase Tpi (TIM) |
| Comments | ML0572, len: 261 aa. Probable tpi, Triosephosphate isomerase (EC 5.3.1.1), highly similar to TPIS_MYCTU|O08408|Rv1438 tpi, triosephosphate isomerase from M. tuberculosis (261 aa), Fasta scores: E(): 0, (83.9% identity in 261 aa overlap). Similar to many e.g. TPIS_CORGL|P19583 tpi, triosephosphate isomerase from Corynebacterium glutamicum (259 aa), Fasta scores: E(): 0, (64.5% identity in 256 aa overlap). Previously sequenced as TPIS_MYCLE|P46711 (261 aa), Fasta scores: E(): 0, (99.6% identity in 261 aa overlap). Contains Pfam match to entry PF00121 TIM, Triosephosphate isomerase. Contains PS00171 Triosephosphate isomerase active site. Belongs to the Triosephosphate isomerase family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 697159 | 697944 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0572|tpi
VSRKSLIAGNWKMNLNHFEAIALVQKIAFSLPDKYYDKVDVTVLPPFTDLRSVQTLVDGDKLRLTYGAQDLSQHDLGAYTGDISGAFLAKLGCSFVLVGHSERRTYHDEGDALVAAKTAAALKNSLTPIVCIGEYLEIREVGEHVSHCQNQLRGSLAGLSPEQIGNVVIVYEPVWAIGTGRVASAADAQEVCEAIRKELGALASPQVAETVRVLYGGSLNAKNIGDIVAQQDVDGGLVGGASLDGAQFATLAVIAAGGPLP
Bibliography
No article yet recorded
