Gene ML0589c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible unidentified antibiotic-transport integral membrane protein ABC transporter |
| Comments | ML0589c, len: 265 aa. Possible unidentified antibiotic-transport integral membrane protein ABC transporter (see citation below), highly similar to O86349|AL123456|Rv1457c Possible unidentified antibiotic-transport integral membrane protein ABC transporter from M. tuberculosis (261 aa), Fasta scores: E(): 3.6e-74, (83.1% identity in 260 aa overlap); and CAD96159|Mb1492c from M. bovis (261 aa). Similar to other bacterial hypothetical membrane proteins e.g. O87317|AF027770 fxtE, hypothetical membrane protein from Mycobacterium smegmatis (236 aa), Fasta scores: E(): 1.6e-60, (77.1% identity in 236 aa overlap). Previously sequenced as Q49703|U00013 (265 aa), Fasta scores: E(): 0, (99.6% identity in 265 aa overlap). Contains hydrophobic, probable membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 714235 | 715032 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0589c|ML0589c
VTQNNTLRNSPLFPAGTFTPNPRPNAVTRMVAAQFMLELKLLLRNGEQLLLTMFIPITLLIGLTLLPLGSFGHHRATTFVPVIMALAVVSSAFTGQAIAVAFDRRYGALKRFGATPLPVWGIIAGKSLAVVTVVFLQAIILGAIGVMLGWRPALICLALGAAIIALGTAGLAALGLLLGGTLRAEIVLAVANLMWFVFAGLGALTVKMNMISAVVKWAARLTPSGALTEALSQAMTLSVDWFGVIILTAWGTLAALAALHWFRFT
Bibliography
No article yet recorded
