Gene ML0592
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable transcriptional regulatory protein |
| Comments | ML0592, len: 254 aa. Probable transcriptional regulatory protein, highly similar to O53151|AL123456|Rv1460 Probable transcriptional regulatory protein from M. tuberculosis (268 aa), Fasta scores: E(): 0, (79.6% identity in 250 aa overlap); and CAD96162|Mb1495 from M. bovis (268 aa). Similar to other bacterial transcriptional regulatory and hypothetical proteins e.g. Q8NQ74 Predicted transcriptional regulator from Corynebacterium glutamicum (Brevibacterium flavum) (231 aa), fasta scores: E(): 2.3e-36, (49.302% identity in 215 aa overlap); and Q9XAD0|AL096839|SCC22.08C putative DNA-binding protein from Streptomyces coelicolor (252 aa), Fasta scores: E(): 5.6e-30, (45.4% identity in 216 aa overlap). Previously sequenced as Q49688|U00013 (254 aa), Fasta scores: E(): 0, (99.6% identity in 254 aa overlap). Contains a probable helix-turn-helix motif at aa 215-236 (Score 1054, SD +2.78) |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 717873 | 718637 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0592|ML0592
VLNVHRGYPSLDRSPELRHTGVVKIRSELDAATTVAVSDGHTRRAVVRLLLESGSITAGEISDRLGLSAAGVRRHLDVLIEMGDAESATAAPWQQVGRGRPAKHYRLTAVGRAKLGHAYDTLASAAMRQLREIGGEDAVRTFARQRIDAILADVEPAGGGADVEAAANRVASALSDAGYVATTARVGGPIHGVEICQHHCPVSHVAEEFPELCETEQQAIAEVLGTHVQRLAMIVNGDCACTTHVPLMSVPSKT
Bibliography
No article yet recorded
