Gene ML0597
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible nitrogen fixation related protein |
| Comments | ML0597, len: 165 aa. Possible nitrogen fixation related protein, highly similar to O53156|AL123456|Rv1465 Possible nitrogen fixation related protein from M. tuberculosis (162 aa), Fasta scores: E(): 0, (79.4% identity in 165 aa overlap); and CAD96167|Mb1500 from M. bovis (162 aa). Also similar to O32163|NIFU_BACSU NifU-like protein from Bacillus subtilis (147 aa), fasta scores: E(): 9.5e-18, (41.481% identity in 135 aa overlap). Previously sequenced as Q49683|U00013 (165 aa), Fasta scores: E(): 0, (100.0% identity in 165 aa overlap). Contains Pfam match to entry PF01883 DUF59, Domain of unknown function. Contains Pfam match to entry PF01592 NifU_N, NifU-like N terminal domain. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 724508 | 725005 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0597|ML0597
MILRLEQIYQEVILDHYKHPQHRGLREPFCAQVYHVNPICGDEITLRVALSDNGASVADISYEGQGCSISQASISVLAQQVIGQSVPDALNIISAFTEMVSSRGTIEGDEDVLGDGVAFAGVAKYPARVKCALLGWMACKDALIHANSADKVLEEVMDEQNHRVG
Bibliography
No article yet recorded
