Gene ML0598
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved hypothetical protein |
Comments | ML0598, len: 115 aa. Conserved hypothetical protein, highly similar to O53157|AL123456|Rv1466 conserved hypothetical protein from M. tuberculosis (115 aa), Fasta scores: E(): 0, (82.6% identity in 115 aa overlap); and CAD96168|Mb1501 from M. bovis (656 aa). Similar to several hypothetical proteins and hypothetical proteins located downstream of sigma factors in Streptococcus mutans and Streptococcus pneumoniae e.g. O06451 ORF3 downstream of RpoD (SPDNAGCPO) (109 aa). Previously sequenced as Q49691|U00013 (115 aa), Fasta scores: E(): 0, (100.0% identity in 115 aa overlap). Contains Pfam match to entry PF01883 DUF59, Domain of unknown function. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 724980 | 725327 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0598|ML0598 MSKITASGDELLADVEEAMRDVVDPELGINVVDLGLVYGLGLEEGKEGMIALVDMTLTSAACPLNDVIEEQSRSALVGSGLVSDLRINWVWNPPWGPDKISDDGREQLRALGFTV
Bibliography
No article yet recorded