Gene ML0607
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0607, len: 279 aa. Conserved hypothetical protein, highly similar to P71734|AL123456|Rv2409c conserved hypothetical protein from M. tuberculosis (279 aa), Fasta scores: E(): 2e-100, (82.1% identity in 279 aa overlap); and similar to YP69_MYCTU|Q50652|Rv2569c conserved hypothetical protein from M. tuberculosis (314 aa), Fasta scores: E(): 4.1e-13, (33.0% identity in 300 aa overlap). Similar to other bacterial hypothetical proteins e.g. Q9RSX6|AE002037|DR1993 conserved hypothetical protein from Deinococcus radiodurans (274 aa), Fasta scores: E(): 8.2e-25, (33.6% identity in 280 aa overlap). And similar to ML0508 from M. leprae. Previously sequenced as YP69_MYCLE|U00016 (279 aa), Fasta scores: E(): 0, (100.0% identity in 279 aa overlap). Contains Pfam match to entry PF01841 Transglut_core, Transglutaminase-like superfamily. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 739212 | 740051 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0607|ML0607
MWRMRVVHSTGYVYESPATASFNEARLTPRSNTRQTVILNRVETIPATRSYRYIDYWGTVVTAFDLRAPHTELTVTSSSVVETESLEPSVSRITWTELQSMAVIDRFDEVLQPTAYTPVNTRVAAVGKRIAKNHEPRKAVVAAARWARSKLDYIPGTTGVHSSGLDALHQCRGVCQDFAHLTLIVLRSMGIPGRYVSGYLHPKRDAVVGKTVEGRSHAWIQAWTGGWWNYDPTNDVEITEQYISVGVGRDYTDVAPLKGIYSGRGATDLDVVVEITRLA
Bibliography
No article yet recorded
