Gene ML0615
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable sulphate-binding lipoprotein SubI |
| Comments | ML0615, len: 348 aa. Probable subI, sulfate-binding lipoprotein component of sulfate transport system (see citations below), highly similar to P71744|AL123456|Rv2400c subI, probable sulfate-binding lipoprotein from M. tuberculosis subI (356 aa), Fasta scores: E(): 1.6e-109, (76.5% identity in 340 aa overlap). Similar to many e.g. SUBI_ECOLI|P06997 sbp, sulfate-binding protein precursor from Escherichia coli (329 aa), Fasta scores: E(): 1.2e-28, (35.7% identity in 291 aa overlap). Previously sequenced as Q49748|U00016 (358 aa), Fasta scores: E(): 0, (100.0% identity in 348 aa overlap). Contains Pfam match to entry PF01100 Sulphate_bind, Prokaryotic sulphate- and thiosulphate-binding protein. Belongs to the prokaryotic sulfate binding protein family. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 748383 | 749429 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0615|subI
MFKDIGRFMRWRHSMVVGVTLASTTDVVAACHGGASDVVGGGTAHAHTSIALVAYSAPGPGWGKVIPAFNDARSGDGVQVVTSYGASGDQSRGVVDGKPADIVNFSVETDITRLVKVGKVSKDWDTDATKGIPFGSVVTLVVRTGNPKNIKDWDDLVRPGVEVIMPNPLSSGSAKWNLLAPYAAKSEGCRNSQAGIDFVNRLVAEHVKLRLGSAREATDAFVQGSGDVLISYENEAIAAERQGKPVEHINPPVTFKIENPLAVVSTSAHLEVATAFKNFQYTTAAQGLWAQAGFRPVDPAVSADFSDQFPAPVKLWTIADLGGWSTVDPQLFDKNTGSITKVYMQATG
Bibliography
No article yet recorded