Gene ML0620 (mtb12)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Low molecular weight antigen, secreted protein |
Comments | ML0620, len: 167 aa. cfp2 (alternate gene name: mtb12), low molecular weight antigen, secreted protein, similar to MB12_MYCTU|O05822|Rv2376c cfp2, low molecular weight antigen from M. tuberculosis (168 aa), Fasta scores: E(): 0, (65.5% identity in 165 aa overlap); and CAD97258|Mb2397c from M. bovis (168 aa). Previously sequenced as MB12_MYCLE|Q49771 (165 aa), Fasta scores: E(): 0, (100.0% identity in 165 aa overlap). Belongs to the mtb12 family. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 753533 | 754036 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0620|cfp2 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPAPAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKNAAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGSWVLSRHSAMELLQAAGR
Bibliography
No article yet recorded