Gene ML0620 (mtb12)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Low molecular weight antigen, secreted protein |
| Comments | ML0620, len: 167 aa. cfp2 (alternate gene name: mtb12), low molecular weight antigen, secreted protein, similar to MB12_MYCTU|O05822|Rv2376c cfp2, low molecular weight antigen from M. tuberculosis (168 aa), Fasta scores: E(): 0, (65.5% identity in 165 aa overlap); and CAD97258|Mb2397c from M. bovis (168 aa). Previously sequenced as MB12_MYCLE|Q49771 (165 aa), Fasta scores: E(): 0, (100.0% identity in 165 aa overlap). Belongs to the mtb12 family. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 753533 | 754036 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0620|cfp2
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPAPAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKNAAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGSWVLSRHSAMELLQAAGR
Bibliography
No article yet recorded