Gene ML0639
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable transcriptional regulatory protein WhiB7 |
| Comments | ML0639, len: 89 aa. Probable whiB7, WhiB-like regulatory protein, highly similar to Rv3197A whiB7, WhiB-like regulatory protein from M. tuberculosis (92 aa), fasta scores: opt: 441, E(): 1.5e-26, (69.318% identity in 88 aa overlap); and CAD95313|Mb3221c from M. bovis (92 aa). Shows similarity to members of the whiB-family of transcriptional regulators e.g. Q8GHG1 WhiB7 from Streptomyces coelicolor A3(2) (122 aa), fasta scores: opt: 316, E(): 9.6e-17, (56.522% identity in 69 aa overlap). Also similar to ML0382, ML0760, ML0804 and ML2307 from M. leprae. Previously sequenced as Q49765|U00016 (89 aa), Fasta scores: E(): 0, (100.0% identity in 89 aa overlap). Contains a match to Pfam entry PF02467; Whib. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 771723 | 771992 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0639|whiB7
MLTLTIPKQTLPGLPCHADTSDLWFAETPADLECTKTLCANCPIRRPCLEAAMERAEPWGVWGGEIFDRGLIVSRKRPRGRPCNDVVVV
Bibliography
No article yet recorded
