Gene ML0640c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved ATP-binding protein ABC transporter |
| Comments | ML0640c, len: 473 aa. Probable conserved ATP-binding protein ABC transporter, highly similar to O53343|AL123456|Rv3197 conserved ATP-binding protein ABC transporter from M. tuberculosis (447 aa), Fasta scores: E(): 0, (83.0% identity in 447 aa overlap); and CAD95312|Mb3220 from M. bovis (447 aa). Similar to other proteins (generally ABC transporters) e.g. Q9FCJ6 Hypothetical protein SCO5192 from Streptomyces coelicolor (469 aa), fasta scores: opt: 1252, E(): 3.3e-72, (46.222% identity in 450 aa overlap). Also similar to ML1898. Previously sequenced as Q49747|U00016 (267 aa), Fasta scores: E(): 0, (99.6% identity in 248 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 772069 | 773490 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0640c|ML0640c
MMRVKARMNNECSRLIIDCHITSMARFTVMDDRRVADIKRGQAARNAKLASIPVGLAGRAVLGLGKRLTGKSKDEVNTKLIEKTAHQLFSVLGELKGGAMKVGQALSVMEAAIPEEYGEPYREALTKLQKDAPPLPVNKVHRVLDAQLGTKWRDRFSSFNDTPVASASIGQVHKAVWSYGREVAVKIQYPGADEALRADLKTMQRMVGILKQLSPGADIQGVVDELVERTEMELDYRLEADNQRAFAKAYQGDPRFVVPNVVASAPKVIIQEWIDGVPMAEIIRNGTAQQRDRMGKLLLELTFDSPRRLEMLHGDAHPGNFMLLSDGRMGVIDFGAIAPLPGGFPVELGMSIRLARDKNYNLLLQTMEKAGLIQKGRQVSVRDIDEMMHQYVEPIKVEVFHYTRKWLQQISLDRSVSHIKTARQLDLPATLALPMRVIASVGAILCQLDAHVPTKALTEKLVPGFAEPDTAIV
Bibliography
No article yet recorded