Gene ML0643
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved secreted protein |
| Comments | ML0643, len: 340 aa. Possible conserved secreted protein, highly similar to O53340|AL123456|Rv3194c conserved hypothetical protein from M. tuberculosis (340 aa), Fasta scores: E(): 0, (80.3% identity in 340 aa overlap); and CAD95308|Mb3216c from M. bovis (340 aa). Similar to other bacterial hypothetical and putative secreted protein e.g. Q8NS96 Predicted secreted protein containing a PDZ domain from Corynebacterium glutamicum (Brevibacterium flavum) (350 aa), fasta scores: opt: 912, E(): 9.5e-49, (42.571% identity in 350 aa overlap); and Q9S3Y5|AF170560 sdrC, hypothetical protein from Streptomyces coelicolor (241 aa), Fasta scores: E(): 5.5e-18, (34.9% identity in 318 aa overlap). Contains a possible N-terminal signal sequence. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 776009 | 777031 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0643|ML0643
VNRRILTLLVALVPILVFGVLLAVVTVPFVSLGPGPTFDTLGEVDGKQVVAIKGAHTHPTSGHLNMTTVSQRDDLTLGEALTLWLSGQEQLVPRDLIYPPGKSREDVDKVNYADFKQSEDSAAYAALGYLQYPSAVTVAKVTDPGQSVGKLKSGDAVDAVNGSPVANVEQFTGLLKKTKPGEVVTIDFRRKNEPPGVVQITLGANKDRDYGFLGVAVLDAPWAPFVVDFNLANVGGPSAGLMFSLAVVDKLTTGDLVGSTFVAGTGTISIDGKVGPIGGIAHKMAAARAAGATVFLVPAKNCYEARSDNRTGLRLVKVESLSQAVDALHAMTSGGQLPSC
Bibliography
No article yet recorded
