Gene ML0662c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable monophosphatase |
| Comments | ML0662c, len: 255 aa. Probable monophosphatase (EC 3.1.3.-), highly similar to P95189|AL123456|Rv3137 Probable monophosphatase from M. tuberculosis (260 aa), Fasta scores: E(): 0, (81.8% identity in 253 aa overlap); and CAD95253|Mb3161 from M. bovis (260 aa). Similar to several e.g. Q9K4B1 Putative monophosphatase from Streptomyces coelicolor (266 aa), fasta scores: opt: 955, E(): 3.7e-56, (56.746% identity in 252 aa overlap). Also similar to ML1024. Previously sequenced as O32889|Z98271 (255 aa), Fasta scores: E(): 0, (100.0% identity in 255 aa overlap). Contains 2 Pfam matches to entry PF00459 inositol_P, Inositol monophosphatase family. Contains PS00629 Inositol monophosphatase family signature 1. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 798767 | 799534 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0662c|ML0662c
MLALTLADRADALTSARFGALNLRVDTKPDLTPVTDADRAVEADVRAVLGRERPKDGILGEEYGGTITFSGQQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSIGVVSAPALQRRWWAARGQGAFVAVDGVPRRLAVSEVADLNSASLSFSSLSGWAQRGLRDRFLELTDAVWRVRAYGDFLSYCLLAEGAIDVAAEPKVSVWDLAALDIVVREAGGVLTGLDGTPGPHGGSAVATNGRLHQEVLTRIGATVK
Bibliography
No article yet recorded