Gene ML0669 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Putative cell division ATP-binding protein FtsE (SEPTATION COMPONENT-TRANSPORT ATP-BINDING PROTEIN ABC TRANSPORTER) | 
| Comments | ML0669, len: 229 aa. Putative ftsE, cell division protein, septation component transport ATP-binding protein ABC transporter, highly similar to O05779|AL123456|Rv3102c ftsE, cell division protein, septation component transport ATP-binding protein ABC transporter from M. tuberculosis (229 aa), Fasta scores: E(): 0, (91.7% identity in 229 aa overlap); and CAD96816|Mb3129c from M. bovis (229 aa). Similar to many e.g. FTSE_ECOLI|P10115 ftsE, cell division ATP-binding protein from Escherichia coli (222 aa), Fasta scores: E(): 0, (49.1% identity in 216 aa overlap). Previously sequenced as O32883|Z98271 (229 aa), Fasta scores: E(): 0, (100.0% identity in 229 aa overlap). Contains Pfam match to entry PF00005 ABC_tran, ABC transporter. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS00211 ABC transporters family signature. BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 805921 | 806610 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0669|ftsE
MITLDHVSKKYKSLARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRLRQVIGCVFQDFRLLQQKTVYENVAFALEVIGRRSDAINQVVPDVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEWCGIYGMDR
      
    Bibliography
    No article yet recorded