Gene ML0671
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable SsrA-binding protein SmpB |
| Comments | ML0671, len: 160 aa. Probable smpB, SsrA-binding protein, highly similar to SMPB_MYCTU|P96294|Rv3100c smpB, SsrA-binding protein from M. tuberculosis (160 aa), Fasta scores: E(): 0, (84.9% identity in 159 aa overlap); and CAD96814|Mb3127c from M. bovis (160 aa). Similar to many e.g. SMPB_ECOLI|P32052 smpB, SSRA-binding protein essential for the peptide-tagging activity of SsrA (tmRNA) from Escherichia coli (159 aa), Fasta scores: E(): 4.1e-19, (41.8% identity in 146 aa overlap). Previously sequenced as SMPB_MYCLE|O32881 (160 aa), Fasta scores: E(): 0, (99.4% identity in 160 aa overlap). Contains Pfam match to entry PF01668 SmpB, SmpB protein. Contains PS01317 Protein smpB signature. BELONGS TO THE SSRP FAMILY. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 807507 | 807989 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0671|smpB
VARNPRGGKQIVATNRKARHDYAIIELFEAGVALLGTEVKSLREGHASLADAFATVDSGEVWLRNMHIPEYQHGSWTNHDPRRNRKLLLHRRQIDTLVGKIRDGNLALVPLSLYFAEGKVKVELALARGKKLHDKRQDMARRDAQREVIRELGRRAKGML
Bibliography
No article yet recorded
