Gene ML0676c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved hypothetical protein |
Comments | ML0676c, len: 158 aa. Conserved hypothetical protein, highly similar to O50383|AL123456|Rv3354 conserved hypothetical protein from M. tuberculosis (129 aa), Fasta scores: E(): 6.2e-24, (55.9% identity in 127 aa overlap) and CAD95533|Mb3389 from M. bovis (129 aa). Also similar to O33192|AL123456|Rv1690, probable lipoprotein lprJ from M. tuberculosis (127 aa), Fasta scores: E(): 2e-09, (33.3% identity in 105 aa overlap). Previously sequenced as O32877|Z98271 (168 aa), Fasta scores: E(): 0, (100.0% identity in 158 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 811816 | 812292 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0676c|ML0676c MFLRLMLSALKALQRLGAVMNSLARIDHWIWLFRCQPLTIRLLVATAALFTAATAFEVPAEADAIDDTFIKALNHAGVNFGEPRSAMTMGHYVCPILAKSGGNFAAAVQRIRGNSDMSPQMAETFAKIAISIYCPTMMANVASGNLPSLPPGPGIPGI
Bibliography
No article yet recorded