Gene ML0687
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | ML0687, len: 313 aa. Probable conserved integral membrane protein, highly similar to O53385|AL123456|Rv3335c conserved integral membrane protein from M. tuberculosis (289 aa), Fasta scores: E(): 0, (68.8% identity in 288 aa overlap); and from CAD95487| M. bovis (289 aa). Similar to several bacterial hypothetical proteins e.g. YHJD_ECOLI|P37642 yhjD, hypothetical protein from Escherichia coli (337 aa), Fasta scores: E(): 5e-30, (34.9% identity in 278 aa overlap); and Q8ZA35 Putative membrane protein from Yersinia pestis (360 aa), fasta scores: E(): 1.9e-31, (35.689% identity in 283 aa overlap). Previously sequenced as Q49909|U00022 (313 aa), Fasta scores: E(): 0, (100.0% identity in 313 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 823170 | 824111 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0687|ML0687
MTEPANTGIIDRLRGRFRWLDHVVRAHQRFDERNGSFFAAGLTYYTIFALFPMLMVSFSVVGLVLFRRPELLTTIDDHIRSAVSSQLGQELVDLMNRAIDARASVGVVGLATAAWAGLCWMSHFRAALTKMWWEHHIDPSSLLRNKLSDLLAMVGTFVVFLTTLALTVLSHQAPMAAILRCIGITHFFVFGVIFQGASVLVSTLVSWLLFTWMIAWLPRKSVNLVASMRGGLIAAVGFELFKQVGSIYLQIVLRSPAGSVFGPVLGVMVFSYFTAYLVLFAASWAATAELCMKPVSVQLPWSYLFPGRDESGS
Bibliography
No article yet recorded
