Gene ML0707c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable purine nucleoside phosphorylase DeoD (INOSINE PHOSPHORYLASE) (PNP) |
| Comments | ML0707c, len: 268 aa. Probable deoD, purine nucleoside phosphorylase (EC 2.4.2.1), highly similar to PUNA_MYCTU|O53359|Rv3307 probable deoD purine nucleoside phosphorylase from M. tuberculosis (268 aa), Fasta scores: E(): 5.8e-81, (82.1% identity in 262 aa overlap). Similar to many others e.g. PUNA_BACST|P77834 deoD, purine nucleoside phosphorylase I from Bacillus stearothermophilus (274 aa), Fasta scores: E(): 6.5e-16, (43.1% identity in 246 aa overlap). Previously sequenced as PUNA_MYCLE|P46862 (268 aa), Fasta scores: E(): 0, (99.6% identity in 268 aa overlap). Contains Pfam match to entry PF00896 Mtap_PNP, phosphorylases family 2. Contains PS01240 Purine and other phosphorylases family 2 signature. BELONGS TO THE PNP/MTAP FAMILY 2 OF PHOSPHORYLASES. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 845461 | 846267 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0707c|deoD
VTYTLLDPDELARRAAQVIGERTGILKHDVAVVLGSGWSSAVAALGSSRAVFPQAELPGFITPNAAGHTGELLSVRIGAHRVLVLAGRIHPYEGHDLRHVVHPVRTACAAGARIIVLTNAAGGLRADMAVGQLVLISDHLNLTTRSPLVGTHFVDLTNAYTTRLRKLASDTDPTLTEGVYAAQPGPHYETPAEIRMLRMLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGKPLNHAEVLAAGTASANRIGSLLADIIARF
Bibliography
No article yet recorded
