Gene ML0733
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | ML0733, len: 172 aa. Probable conserved transmembrane protein, highly similar to Rv3278c|MTCY71.18c|P96883|Z92771 conserved transmembrane protein from Mycobacterium tuberculosis (172 aa), fasta scores: E(): 0, (83.1% identity in 172 aa); and CAD95398| from M. bovis (172 aa). Previously sequenced as Q49672|U00012. Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 874678 | 875196 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0733|ML0733
MRYPGNTLVAGEQVVLHRHPHWKRLIWPAVVLILATGLVSFGSGYVNSTHWAQVAKNVIYGVLWGVWLVIVGWLTLWPFLNWLTTHFVVTNRRVMFRQGTLTRSGVDIPLARINSVEFRDRLFERMFRTGTLIIESASQDPVEFYNIPRLRQMYALLYHEVFDTLGSEESPS
Bibliography
No article yet recorded