Gene ML0758c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable F420 biosynthesis protein FbiB |
| Comments | ML0758c, len: 457 aa. Probable fbiB, F420 biosynthesis protein, equivalent to FBIB F420 biosynthesis protein fbiB from Mycobacterium bovis BCG (see citations below). Highly similar to Rv3262|MTCY71.02|P96867|Z92771 Probable fbiB, F420 biosynthesis protein from Mycobacterium tuberculosis (448 aa), fasta scores: E(): 6.9e-138, (82.2% identity in 445 aa), and to SCE34.18|Q9KZK8|AL353862 putative oxidoreductase from Streptomyces coelicolor (443 aa), fasta scores: E(): 5.4e-65, (50.8% identity in 455 aa); and several hypothetical bacterial proteins. Contains Pfam match to entry PF00881 Nitroreductase, Nitroreductase family. Contains Pfam match to entry PF01996 DUF129, Protein of unknown function. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 900394 | 901767 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0758c|fbiB
VTSSDSHRSAPSPEHGTASTIEILPVAGLPEFRPGDDLSAALAAAAPWLRDGDVVVVTSKVVSKCEGRLVPAPEDTRGRNELRRKLINDETIRVLARKGRTLIIENGLGLVQAAAGVDGSNVGRGELALLPVNPDASAAVLRIGLRAMLGVNVAVVITDTMGRAWRNGQTDVAIGAAGLAVLHNYSGAVDRYGNELVVTEIAVADEVAAATDLVKGKLTAMPVAVVRGLSPTDDGSTAQHLLRNGPDDLFWLGTTEALELGRQQAQLLRRSVRQFSDEPIAAELIETAVAEALTAPAPHHTRPVRFVWLQTPAVRTRLLDRMADKWRLDLASDALPADAIAQRVARGQILYDAPEVIIPFMVPDGAHAYPDAARASAEHTMFIVAVGAAVQALLVALAVRGLGSCWIGSTIFADDLVRAELELPADWEPLGAIAIGYAHEPTDLREPVRVADLLLRK
Bibliography
No article yet recorded