Gene ML0772
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable thymidylate kinase Tmk (dTMP KINASE) (THYMIDYLIC ACID KINASE) (TMPK) |
| Comments | ML0772, len: 210 aa. Probable tmk, thymidylate kinase (EC 2.7.4.9), highly similar to MTCY20B11|Rv3247c|O05891|Z95121 Probable tmk, thymidylate kinase from Mycobacterium tuberculosis (214 aa), fasta scores: E(): 0, (77.3% identity in 207 aa); and CAD95367| from M. bovis (214 aa). Also similar to other thymidylate kinases e.g. Q8NSC3 Thymidylate kinase from Corynebacterium glutamicum (Brevibacterium flavum) (203 aa), fasta scores: E(): 6.9e-29, (50.746% identity in 201 aa overlap); and KTHY_HUMAN|P23919 thymidylate kinase tymK from Homo sapiens fasta scores: E(): 0.005, (29.1% identity in 196 aa). Contains Pfam match to entry PF02223 Thymidylate_kin, Thymidylate kinase. Contains PS01331 Thymidylate kinase signature. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. BELONGS TO THE THYMIDYLATE KINASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 915145 | 915777 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0772|tmk
VLIAIEGVDGAGKRTLSEELRQAFEATGKSVATLAFPRYRQSVAADIAAEALHGQHGDLASSVYAMALLFAFDRAGAVEDIEALDRNHDIVILDRYVASNAAYSAARLHEDCSGRAVAWVQRIEYQRLRLPSPDWQVLLAVSVELAGKRSRYRARTDPDRLRDSYERDDGLQQRTGAVYAGLAAADWGGRWLVVDADIDSGWLVATLMGC
Bibliography
No article yet recorded
