Gene ML0781
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0781, len: 160 aa. Conserved hypothetical protein, highly similar to Rv3237c|MTCY20B11.12c|O05882|Z95121 Conserved hypothetical protein from Mycobacterium tuberculosis (160 aa), fasta scores: E(): 0, (80.6% identity in 160 aa): and CAD95357|Mb3265c from M. bovis (160 aa). Similar to other hypothetical bacterial proteins and more weakly to putative potassium channels e.g. Q9RV81|AE001964|DR1148 conserved hypothetical protein from Deinococcus radiodurans (175 aa), fasta scores: E(): 1.1e-19, (38.0% identity in 158 aa); Q58752|YD57_METJA Putative potassium channel protein from Methanococcus jannaschii (343 aa), fasta scores: E(): 0.0081, (32.000% identity in 75 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 925682 | 926164 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0781|ML0781
MDVKEVLLPGVGLRYEFTSRKGDRIGIIARRSGDFDVVVYARDDPDWAQPVFCLTDDEAEAVAQILGAPRIAERFTELASEVPGLETRQVRIAPESLFVDRPLGDTHARTRTGASIVAIVRDEDVVVSPGPAEPLRARDVLIVIGTEEGIAGVEQIIDKG
Bibliography
No article yet recorded