Gene ML0782
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable conserved integral membrane transport protein |
| Comments | ML0782, len: 385 aa. Probable conserved integral membrane transport protein, possibly cation (Na/H) transporter, highly similar to Rv3236c|MTCY20B11.11c|O05881|Z95121 Probable conserved integral membrane transport protein from M. tuberculosis (385 aa), fasta scores: E(): 3.8e-117, (81.8% identity in 385 aa); and CAD95356|Mb3264c from M. bovis (385 aa). Similar to others e.g. O69958 Putative transmembrane transport protein from Streptomyces coelicolor (411 aa), fasta scores: E(): 1.5e-69, (51.882% identity in 372 aa overlap); and weakly similar to KEFB_ECOLI|P45522 glutathione-regulated potassium-efflux system protein kefB from Escherichia coli, fasta scores: E(): 4.7e-13, (26.0% identity in 362 aa). Contains hydrophobic, possible membrane-spanning regions. SEEMS TO BELONG TO THE CPA2 FAMILY. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 926169 | 927326 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0782|ML0782
MEISGALLSQVGALLTTLAVLGAGARRYSLSPIPVYLMAGLSLGKGGIMPVSAADEFITTGAPIGIVLLLLTLGLEFSATEFASSLRRHLPSAGVDIILNATPGAVAGWLLGLDGVAVLALAGVTYISSSGVIARLLADLRRLGNRETPAVLSVLVLEDFAMAAYLPLFAVLAAGGSWLDAVVGMIVAVCALFAAFAASYHWGHHVGRLVAHPDSEQLLLRVLGVTLIVAAVAESLHASAAVGAFLVGLTLTGDTAERARKVLGPLRDLFAAIFFLAIGISVDPHKLLPMFPTALILATVTAVTKVATGILAARYDGVARRGQLRAGTALVARGEFSLIIIGLVGTSTPAVAALATAYVFIMAIAGPVLARYTPGSLPTSSGSAN
Bibliography
No article yet recorded
