Gene ML0814
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein TB9.4 homolog |
| Comments | ML0814, len: 82 aa. Conserved hypothetical protein, similar to M.tuberculosis Rv3208A (90 aa), and similar to Streptomyces coelicolor hypothetical protein. FASTA scores: Rv3208A, E(): 3e-32, 82% identity in 82 aa; AL390975|AL390975_32 Streptomyces coelicolor (94 aa) E(): 2.5e-09; 47.945 % identity in 73 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 963596 | 963844 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0814|ML0814
VEVKIGITDSPRELTFSSAQTPGEIEELVSAALREGLGLLVLTDERGRRFLIHGAKIAYVEIGVADARRVGFGIGAESATNG
Bibliography
No article yet recorded