Gene ML0834c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0834c, len: 100 aa. Conserved hypothetical protein. Similar to Rv2342|MTCY98.11|P95238|Z83860 Mycobacterium tuberculosis hypothetical protein (85 aa), fasta scores: E(): 3e-21, 76.9% identity in 78 aa and shows weak similarity to Streptomyces coelicolor putative secreted protein SCC24.32|CAB86126|AL163003 (108 aa) fasta scores: E(): 0.035, 30.5% identity in 95 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 990404 | 990706 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0834c|ML0834c
VRQDGASRTVVGGTALIRYVIVLGLGYVLGAKAGRRRYEQIVGIYRTLTGSPMAKSMIAEGRRKVANRISPDEGFVTLAEIDNQTTVIERSAEWRENGGN
Bibliography
No article yet recorded