Gene ML0871
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML0871, len: 118 aa. Similar to Mycobacterium tuberculosis hypothetical 12.5 kDa protein Rv2204c or MTCY190.15C SW:YM04_MYCTU (Q10393) (118 aa) fasta scores: E(): 0, 92.4% identity in 118 aa. Similar to many hypothetical proteins e.g. Streptomyces coelicolor hypothetical 12.4 kDa protein SC6G10.34C TR:Q9X819 (EMBL:AL049497) (118 aa) fasta scores: E(): 0, 73.7% id in 118 aa. Contains Pfam match to entry PF01521 HesB-like, HesB-like domain. Contains PS01152 Hypothetical hesB/yadR/yfhF family signature. BELONGS TO THE HESB/YADR/YFHF FAMILY. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1035227 | 1035583 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0871|ML0871 MAVQNELSAKTHGVILTDVAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDLTAEFGGVTLTVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNANGSCACGDSFN
Bibliography
No article yet recorded