Gene ML0871 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved hypothetical protein | 
| Comments | ML0871, len: 118 aa. Similar to Mycobacterium tuberculosis hypothetical 12.5 kDa protein Rv2204c or MTCY190.15C SW:YM04_MYCTU (Q10393) (118 aa) fasta scores: E(): 0, 92.4% identity in 118 aa. Similar to many hypothetical proteins e.g. Streptomyces coelicolor hypothetical 12.4 kDa protein SC6G10.34C TR:Q9X819 (EMBL:AL049497) (118 aa) fasta scores: E(): 0, 73.7% id in 118 aa. Contains Pfam match to entry PF01521 HesB-like, HesB-like domain. Contains PS01152 Hypothetical hesB/yadR/yfhF family signature. BELONGS TO THE HESB/YADR/YFHF FAMILY. | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 1035227 | 1035583 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0871|ML0871
MAVQNELSAKTHGVILTDVAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDLTAEFGGVTLTVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNANGSCACGDSFN
      
    Bibliography
    No article yet recorded