Gene ML0876
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved integral membrane protein |
| Comments | ML0876, len: 139 aa. Possible conserved integral membrane protein. Similar to Mycobacterium tuberculosis hypothetical 14.9 kDa protein Rv2199c or MTCY190.10C SW:YL99_MYCTU (Q10406) (139 aa) fasta scores: E(): 0, 91.4% identity in 139 aa and to Streptomyces coelicolor hypothetical proteins e.g. putative integral membrane protein SC6G10.27C TR:Q9X812 (EMBL:AL049497) (132 aa) fasta scores: E(): 6.2e-15, 38.8% identity in 139 aa. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1040899 | 1041318 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0876|ML0876
MHIEARLFEFVAVFFVIMAVLYGVLTSMFATGGVDWVGTTALALTGGLALIVATFFRFVARRLDIRPEDYEGAEISDGAGELGFFSPHSWWPVLVALSGSVAAVGIALWLPWLIVAGVVFVLASAAGLVFEYYVGPEKH
Bibliography
No article yet recorded