Gene ML0895
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0895, len: 171 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:O69570 (EMBL:AL022602) (171 aa), Fasta scores: E(): 0, 100.0% identity in 171 aa overlap and highly similar to Mycobacterium tuberculosis hypothetical protein TR:O53513 (EMBL:AL021957) (168 aa), Fasta scores: E(): 0, 83.1% identity in 166 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1061011 | 1061526 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0895|ML0895
MRYFYDTEFIEDGRTIELVSIGVVAEDGREYYAVSNEFDPERAGNWVRVNVLSKLPPLASQLWRSRRQIRLDLEEFFGVDGSEPTEPIELWAWVGAYDHVALCQLWGPMPDLPEALPRFTREIRQLWEDRGCPRMPPRPRDLHDALVDARDQLRRFRIIMSADDVGSLPTH
Bibliography
No article yet recorded