Gene ML0898
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical regulatory protein |
| Comments | ML0898, len: 134 aa. Conserved hypothetical protein, possibly involved in regulation. Identical to the previously sequenced Mycobacterium leprae putative transcriptional regulator TR:O69567 (EMBL:AL022602) (134 aa), Fasta scores: E(): 0, 99.3% identity in 134 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2175c TR:O5350 (EMBL:AL021957) (146 aa), Fasta scores: E(): 0, 82.1% identity in 134 aa overlap. Contains a probable helix-turn-helix motif at aa 18-39 (Score 1581, SD +4.57) |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1064346 | 1064750 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0898|ML0898
VGSIPAGDDVLDPDEPTYDLTQVAELLGIPVSRVHRKLCEGYLVAVRRGDSLVVPQIFFTNSGAVVKSLPGLLTILHDGSFHETEIVRWLFTPDPSLTLTRDGSRDVVSNARPVDALHTHQAREVVRRAQAMAY
Bibliography
No article yet recorded