Gene ML0901
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0901, len: 304 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:O69565 (EMBL:AL022602) (304 aa), Fasta scores: E(): 0, 99.7% identity in 304 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2172c TR:O53506 (EMBL:AL021957) (301 aa), Fasta scores: E(): 0, 80.9% identity in 299 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1067603 | 1068517 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0901|ML0901
VTLNTIALELVPPNLDAGQERAVEDACKVVQYSAESGLSGRIRHVMIPGMIVEEDDRPIPMKPKLDVLDFWSIVRPELPGVNGLCTQVTAFMDEASLGRRLADLSAAGMEGVVFVGVPRTMNDGEGSGVAPTDALSMYRELVANRGVIVIPTRDGEQDRLNFKCNQGATYGMTQLLYSDAIVRFLTEFAKHTDHRPELLLSFGFVPKAERRVGLINWLIQDSGNAAVADEQEFVKRLAGSEPAQKRQLMLDLYQRVIDGVAELGFPLSIHFEATYGMSPAAFDTFAEMVAYWPPVCVGQSGEST
Bibliography
No article yet recorded