Gene ML0902c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | probable conserved lipoprotein LppM |
Comments | ML0902c, len: 239 aa. Probable lppM, conserved lipoprotein. Identical to the previously sequenced Mycobacterium leprae putative lipoprotein TR:O69564 (EMBL:AL022602) (239 aa), Fasta scores: E(): 0, 99.6% identity in 239 aa overlap and also highly similar to another putative lipoprotein from Mycobacterium tuberculosis TR:O53505 (EMBL:AL021957) (227 aa), Fasta scores: E(): 0, 75.4% identity in 224 aa overlap. Contains a possible N-terminal signal sequence. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1068514 | 1069233 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0902c|lppM VRARFPPLFTRGCTAQRRRTLTIALLLVAMVPLATGCLRVTASITISPDNLVSGKIIAAAKPKNKNDAGPQLNDNLPFSQKIAVSNYNSDGYVGSQAVFSDLTFAELPQLANMNSSTTDVTLSLRRNGNLVILESRADLTSVTDPDADVELTVAFPGVVTSTNGDRIETKVVAWKLKPGVVSTMSARARYTDPDTRSFTGAAVWLGIASFSAASVVVLLAWNERKSSARLQIPRDSSSS
Bibliography
No article yet recorded