Gene ML0918
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein YfiH |
| Comments | ML0918, len: 249 aa. Probable yfiH, conserved hypothetical protein. Similar to many proteins of unknown function including: Mycobacterium tuberculosis Rv2149c TR:O06227 (EMBL:Z95388) (250 aa), Fasta scores: E(): 0, 60.2% identity in 244 aa overlap and Streptomyces griseus SW:YFIH_STRGR (P45496) (246 aa), Fasta scores: E(): 5.8e-21, 38.0% identity in 245 aa overlap. Note both of these examples are also found downstream of FtsZ. Belongs to the UPF0124 family. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1088461 | 1089210 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0918|yfiH
VGGFADTGQVSVRIRWVITMRAGGVLVSPFDFLDLGDHVGDDPDCGGHLSRAWLVAAIGLGVDRVVWMSQVHGDRVKVVHEPCDAVVDNTDALVTRTSQPALPVVTIHCVPVLLSDARPGVTAAVHVGEGRGSARCASPCDGYDAGPGCVRWRRDIAVLLGPAVSGRNYEVPVVIADGVEAASPDSCTTTRISAGTPGLDLRTGIACQFRDLGVMSIEDDPRRTVADRALFSHLQTVSTGRLASLVWME
Bibliography
No article yet recorded