Gene ML0921
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | ML0921, len: 96 aa. Possible conserved transmembrane protein. Similar to several proteins of unknown function e.g. Mycobacterium tuberculosis Rv2146c TR:O06230 (EMBL:Z95388) (96 aa), Fasta scores: E(): 2.8e-32, 88.5% identity in 96 aa overlap and Streptomyces coelicolor TR:Q9S2X3 (EMBL:AL109663) (94 aa), Fasta scores: E(): 2.9e-12, 40.7% identity in 86 aa overlap. Contains possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1090814 | 1091104 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0921|ML0921
LALFYQILGLALFVFWLLLIARVVVEFIRSFSRDWRPNGVTVVILETIMSITDPPVKLLRRLIPQLTIGAVRFDLSIMVLLLVAFIGMQLALSAAA
Bibliography
No article yet recorded