Gene ML0923
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable transmembrane protein |
| Comments | ML0923, len: 130 aa. Probable transmembrane protein. Highly similar to Mycobacterium tuberculosis hypothetical protein Rv2144c TR:O06231 (EMBL:Z95388) (118 aa), Fasta scores: E(): 1.3e-12, 50.4% identity in 129 aa overlap. Contains a possible membrane spanning hydrophobic domain. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1092224 | 1092616 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0923|ML0923
MLIIALVLALIGLVVLVFAVATSNLLMAWVCIGASVLGVLLLIVDAVREHQCIDAANNEDKEDTDQDDGAVYVDYLDEVPAGTSTEAPDAGSQEGDTNSGELSGYWGRLTIDTGEQSAVAADDHDNDRAT
Bibliography
No article yet recorded