Gene ML0984c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein. |
| Comments | ML0984c, len: 149 aa. Conserved hypothetical protein. Almost identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49850 (EMBL:U00019) (178 aa), Fasta scores: E(): 0, 100.0% identity in 149 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2740 TR:O33283 (EMBL:AL008967) (149 aa), Fasta scores: E(): 3e-28, 52.0% identity in 150 aa overlap. |
| Functional category | Conserved hypotheticals, Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1151027 | 1151476 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0984c|ML0984c
VAIAELTEASVQGVENIRTVEVFLAALQDAGLRNRIRDVGRQPRVYQNVGLPTIHGRSKTITLWRKMADCIGFEIKIHRIAAVAIAVLCERADAVIVGPLWMQFWVCGTFEVQNKRIMLWRNYFDLFDLFKATMRSLVALRIPSLNAAF
Bibliography
No article yet recorded