Gene ML1006
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML1006, len: 161 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49838 (EMBL:U00019) (138 aa), Fasta scores: E(): 0, 100.0% identity in 138 aa overlap. Note this CDS is 23 aa longer than the previously published sequence due to the assignment of the translational start site. Also highly similar to a number of other proteins of unknown function e.g. Mycobacterium tuberculosis Rv2717c TR:O07216 (EMBL:Z96072) (164 aa), Fasta scores: E(): 0, 73.8% identity in 164 aa overlap. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1177173 | 1177658 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1006|ML1006 MPSDLCPDLQALAPLLGSWVGRGMGKYPTIQPFEYLEEVVFSHLDRPFLTYTQKTRAITDGKPLHAETGYLRVPQPGHIELVLAHHSDIAEIEVGTYSVTGDLIEVELVTTTIGLVPTAKQVTALGRFFRIDGDEFAYSVQMGAVGQPLQDHLVAVLHRKQ
Bibliography
No article yet recorded