Gene ML1016
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1016, len: 107 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae TR:Q49984 (EMBL:U15181) (107 aa), Fasta scores: E(): 0, 99.1% identity in 107 aa overlap. Also highly similar to several proteins of undefined function e.g. Mycobacterium tuberculosis conserved hypothetical protein Rv2708c TR:O07209 (EMBL:Z96072) (82 aa), Fasta scores: E(): 9.2e-29, 87.8% identity in 82 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1185906 | 1186229 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1016|ML1016
VSGFCFSVGRVRRHNVTMLGRHNVTMLGMQTQTIEHTYTDEHVDDGTGSDTPKYFHYVKKDKIVESAVMGSHVVALCGEVFPVTRAAKPGSPVCSDCKRVYDMLKKG
Bibliography
No article yet recorded