Gene ML1026
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1026, len: 100 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q4998. Also highly similar to hypothetical proteins from Mycobacterium tuberculosis Rv2699c TR:O07201 (EMBL:Z96072) (100 aa), Fasta scores: E(): 0, 96.0% identity in 100 aa overlap and Streptomyces coelicolor TR:O54130 (EMBL:AL021530) (98 aa), Fasta scores: E(): 3.4e-26, 70.4% identity in 98 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1193571 | 1193873 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1026|ML1026
MPTDYDAPRRTETDNVPEDSLEELKARRNEAASAVVDVDESESAESFELPGADLSGEELSVRVIPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCTA
Bibliography
No article yet recorded