Gene ML1027c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable transmembrane protein |
Comments | ML1027c, len: 157 aa. Probable transmembrane protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49991 (EMBL:U15181) (157 aa), Fasta scores: E(): 0, 99.4% identity in 157 aa overlap. Also highly similar to proteins of unknown function from Mycobacterium tuberculosis Rv2698 TR:O07200 (EMBL:Z96072) (161 aa), Fasta scores: E(): 0, 78.9% identity in 161 aa overlap and Streptomyces coelicolor TR:O54132 (EMBL:AL021530) (154 aa), Fasta scores: E(): 1.1e-08, 33.6% identity in 149 aa overlap. Contains possible membrane spanning hydrophobic domains. Contains a probable helix-turn-helix motif at aa 87-108 (Score 1009, SD +2.62) |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1193878 | 1194351 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1027c|ML1027c VSGTPVAPHNVRYRERLWVPWWWWPLAFALASLIAFEVNLSGATLPSWLPFAVAAGTLLWLGRVEIQVIADAPLGGSVELWAGNAHLPITAIAQSAAISRSAKSAALGRQLDPAAYVLHRAWVGPMILVVLDDPDDPTPYWLVSCRHPERVLSALRS
Bibliography
No article yet recorded