Gene ML1037c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1037c, len: 184 aa. Conserved hypothetical protein. Identical to the previously sequenced Mycobacterium leprae hypothetical protein TR:Q49999 (EMBL:U15181) (184 aa), Fasta scores: E(): 0, 99.5% identity in 184 aa overlap. Also highly similar to Mycobacterium tuberculosis hypothetical protein Rv2683 TR:O07185 (EMBL:Z96072) (165 aa), Fasta scores: E(): 0, 73.8% identity in 164 aa overlap. Contains 2 Pfam matches to entry PF00571 CBS, CBS domain. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1200582 | 1201136 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1037c|ML1037c
VSHEYWSTAVSCNPGIHHIVRLDVAHTPRTTQTYRHSMLAEDIAEDFPAISINSSALDAARMLAEHGLPGLLVTDMSDKPYAVLPASQVVRFIVPRYIQDDPSLAGVLNESTADQAAEKLSSKKVRDVLPDHLVNVSPVNADDTIIEVAATMSRQRSPLLAVVKGGQLLGVITASRLLRAALKH
Bibliography
No article yet recorded